Check It Onion ?

"Check It Onion" monitors the status of your favorite web sites and checks whether they are down or not. Check a website status easily by using the below test tool. Just enter the url and a fresh site status test will be performed on the domain name in real time using our online website checker tool.

To ensure your privacy and security, the Tor Browser is recommended for visiting this website. You can download the Tor Browser by visiting torproject.org. After installing the Tor Browser, copy the onion address below to continue visiting the "Check It Onion" website.

Check It Onion address: http://checkitzh2q35xf42lrtxc6a4o2aqpvvu5dpdophhl44rnqla7ffpkid.onion

Enter a keyword or domain below to check whether it is down or not...

Search Result - Hire a killer
Iván Ávalos - Iván Ávalos
4heb-ogad.onion is down. Checked 6 hours ago.
∀P⊕C∀L!PS!S
4h7t-smid.onion is down. Checked 1 day ago.
Various shared debconf.org files
4ja5-w4yd.onion is up. Checked 4 hours ago.
/sci/ - Catalog
4jnd-xrqd.onion is up. Checked 5 hours ago.
Deep Breaths
4jw3-hvqd.onion is down. Checked 1 day ago.
iLearning
4kd5r3c4xtrcxm2eyw7d7azq4vgv5eigbmuzahz2vzlejdg4ppr6kjqd.onion is down. Checked 1 day ago.
Shop - DRUGS FOR SALE | GUNS FOR SALE | PASSPORTS | [email protected]
4kmk-3kad.onion is up. Checked 23 hours ago.
Dark Web Traffic Boost - Home
4kyl4wxsmbl5mquono3vnbp72kgchl3es6rbsvrp5uxla7cwuxt2uaid.onion is down. Checked 19 hours ago.
ÆLDERITCH
3md5-q4id.onion is down. Checked 1 day ago.
Suspended
3md5-ixad.onion is down. Checked 9 hours ago.
Fresh onions
3mcm-wfyd.onion is up. Checked 23 hours ago.
TRUST STORE - TRUST STORE
3j22-boqd.onion is up. Checked 1 day ago.
CC Cards / buy Western Union / best PayPal
3uw7-svqd.onion is up. Checked 21 hours ago.
Safari in the War
45f6-shyd.onion is up. Checked 3 hours ago.
Venetor Dark Net - Blog
45hnzueioajsohf6wbmgetfcqqsjjxi243wnqhnht7mfrygih3jhawad.onion is down. Checked 2 hours ago.
dumb
45wl7huszlmd3ikrzstqkgqg2w5sv7uljyzclknbi4oqulqebgb356ad.onion is up. Checked 4 hours ago.
Parckwart’s Website
45tb-wkid.onion is up. Checked 7 hours ago.
Hacker Team Professional
45y4-vsyd.onion is up. Checked 4 hours ago.
(Untitled)
4dxfrggybl74yftkqffbyb63ult6l4b47wrkhgbvladmuqjcrq5rsbid.onion is down. Checked 1 day ago.
Latest Sites Checked
hyzmpq2fg4x7jrhyeap4kruohxs6owkbxeebnropoarlq6kfmcjnuaqd.onion - Dopassic Park – Where dope is as big as dinosaurs
Server is up. Last checked 31 seconds ago.
anowddbdpl7d4mo2ovi72e6llulp47qr6h6hgrvd44dv7fc56hu6ytyd.onion - ANOW — Anonymous Crypto Escrow Platform
Server is up. Last checked 35 seconds ago.
Server is up. Last checked 54 seconds ago.
Server is up. Last checked 58 seconds ago.
goodxijl5myiqnxmrq76lzhc4buu3aee4frbnt76nsa24ytgkuw25qyd.onion - Agora road Marketplace – best onion market - agora road mark ...
Server is up. Last checked 1 minute ago.
Server is up. Last checked 1 minute ago.
Server is up. Last checked 1 minute ago.
bvten5sviu2xvdgxo2zjxebqajq7qv7mdvsddzh4czso6rdpwtclokad.onion - Beneath VT – Exploring Virginia Tech's steam tunnels and bey ...
Server is up. Last checked 2 minutes ago.
btc75f5yfeul6nwwzua2vyyfrqksnfqiby4vjfo57d4lqqit4rernxid.onion - Bitcoin Wallet | Buy Bitcoin Wallets 2026
Server is up. Last checked 2 minutes ago.
Server is up. Last checked 2 minutes ago.
Down Right Now
nnr2divekgyallk2v2gvv677snlpc2kh6eoasxr7q3zq56kcukdmhjyd.onion - Cloned cards buy � CLONED CARDS WITH PIN
Server is down. Last checked 20 seconds ago.
nullmesrll647fi66mt6emm4ujbdctlkywfwkqghrdhacewawceittad.onion - NULL Message - Self-destructed encrypted messages
Server is down. Last checked 24 seconds ago.
nlg6nueddb7bz66s5uwiny4zwsjxj3xnsje2zmvtyhjyyson42a6rgid.onion - Credit Card Dumps - PayPal transfer BTC
Server is down. Last checked 27 seconds ago.
bh2r53z4y6oy46pwbz4ujfi6qmnaz6pv6ng6cqjp7gday277jzcu5uid.onion - Site hosted by Daniel's sdfs fsd hosting service
Server is down. Last checked 28 seconds ago.
hosting2t672fmnylbc5t7wz6zksjdwolv7xspinatyylriiv6giadad.onion - Hostings accepting cryptocurrency payments
Server is down. Last checked 29 seconds ago.
bh3ixcdsub6eezlpnpchzofrqao37ljvc2dv366qlvgmyhafeiyyvcad.onion - Site hosted by giel's hosting service
Server is down. Last checked 32 seconds ago.
Server is down. Last checked 33 seconds ago.
Server is down. Last checked 34 seconds ago.
Server is down. Last checked 41 seconds ago.
Server is down. Last checked 41 seconds ago.