Check It Onion ?

"Check It Onion" monitors the status of your favorite web sites and checks whether they are down or not. Check a website status easily by using the below test tool. Just enter the url and a fresh site status test will be performed on the domain name in real time using our online website checker tool.

To ensure your privacy and security, the Tor Browser is recommended for visiting this website. You can download the Tor Browser by visiting torproject.org. After installing the Tor Browser, copy the onion address below to continue visiting the "Check It Onion" website.

Check It Onion address: http://checkitzh2q35xf42lrtxc6a4o2aqpvvu5dpdophhl44rnqla7ffpkid.onion

Enter a keyword or domain below to check whether it is down or not...

Search Result - Father and Daughter
Kikuri.moe Lemmy - A private free-speech and anti-censorship instance.
r3skflyxamq2nz4kdiqoqf46hd2owy3jjnsjpmeldkxnsyyr6tulkwqd.onion is up. Checked 7 hours ago.
Ask Me
qfac-oqqd.onion is down. Checked 1 day ago.
ATM Skimmer for Sale - Cheap ATM Skimmer - Buy ATM Skimmer
qq5j-xxad.onion is up. Checked 59 minutes ago.
Simon Ramsay
rams-cjyd.onion is up. Checked 22 hours ago.
OnionRanks - Hidden Services Discovery & Traffic Analytics
rank-tqad.onion is up. Checked 18 hours ago.
RansomLook — Open ransomware intelligence
rans-i2yd.onion is up. Checked 20 hours ago.
Buy PayPal Money Now - Free PayPal Cash Transfer
qhcx-cvyd.onion is down. Checked 6 hours ago.
Mexican Mafia
qjq3-acid.onion is up. Checked 11 hours ago.
Tor Links Directory - Verified Secure Markets & Vendors Services
qojb-omid.onion is up. Checked 2 hours ago.
Forgejo
qt5v-qhid.onion is up. Checked 23 hours ago.
CoinPro
qej3-zmid.onion is down. Checked 21 hours ago.
Ask darknet expert Archives - Darknet marketplaces onion link.
qwjmcpq3e6ohrfspyktnt4sj2as6twbkas2aaatm5shasmm76j4hwzad.onion is down. Checked 4 hours ago.
RR Anonymous Chat – Secure, Encrypted, and Untraceable
redr-iwyd.onion is up. Checked 6 hours ago.
Red Room - Privacy and Exclusivity
redr-kpqd.onion is up. Checked 5 hours ago.
RelateList - New era of Intelligence
rela-pxqd.onion is up. Checked 1 hour ago.
CARDING Official - Secure & Instant Gift Card Marketplace
rewa-xiqd.onion is down. Checked 10 hours ago.
0ut3r Space
reyc-joyd.onion is up. Checked 19 hours ago.
eCards - Credit Cards Store
rpdq-juqd.onion is down. Checked 5 hours ago.
Royal Class Cards — Buy CC with balance. Verified!
roya-c6qd.onion is up. Checked 22 hours ago.
Earn easy with EnergyFather affiliate program
robopaym4wpa4ed6yecv3e54eyyxizfvu2lqjpvp5qi7ard7uc764qyd.onion is up. Checked 4 hours ago.
Latest Sites Checked
Server is up. Last checked 40 seconds ago.
Server is up. Last checked 59 seconds ago.
Server is up. Last checked 1 minute ago.
Server is up. Last checked 1 minute ago.
Server is up. Last checked 1 minute ago.
Server is up. Last checked 1 minute ago.
pflujznptk5lmuf6xwadfqy6nffykdvahfbljh7liljailjbxrgvhfid.onion - Onion Mail — Anonymous Encrypted Email | ProtonMail & Tuta A ...
Server is up. Last checked 2 minutes ago.
Server is up. Last checked 5 minutes ago.
Server is up. Last checked 5 minutes ago.
Server is up. Last checked 5 minutes ago.
Down Right Now
Server is down. Last checked 35 seconds ago.
Server is down. Last checked 44 seconds ago.
Server is down. Last checked 46 seconds ago.
Server is down. Last checked 50 seconds ago.
Server is down. Last checked 1 minute ago.
Server is down. Last checked 1 minute ago.
Server is down. Last checked 1 minute ago.
Server is down. Last checked 1 minute ago.
Server is down. Last checked 1 minute ago.
nullmesrll647fi66mt6emm4ujbdctlkywfwkqghrdhacewawceittad.onion - NULL Message - Self-destructed encrypted messages
Server is down. Last checked 1 minute ago.