Check It Onion ?
"Check It Onion" monitors the status of your favorite web sites and checks whether they are down or not. Check a website status easily by using the below test tool. Just enter the url and a fresh site status test will be performed on the domain name in real time using our online website checker tool.
To ensure your privacy and security, the Tor Browser is recommended for visiting this website. You can download the Tor Browser by visiting torproject.org. After installing the Tor Browser, copy the onion address below to continue visiting the "Check It Onion" website.
Check It Onion address: http://checkitzh2q35xf42lrtxc6a4o2aqpvvu5dpdophhl44rnqla7ffpkid.onion
Enter a keyword or domain below to check whether it is down or not...
Search Result - Tor verified links | Link directory
d
g3j4-kgad.onion is down. Checked 1 day ago.
TorriumHost - Tor Web Hosting
gyvihywdcqirutvuilnne7s2y6c7qfsxya74xecheg3majih4twjw6qd.onion is down. Checked 1 day ago.
Excavator - search in darknet
iaw37a2sht2ppkjnv3j4wtkqeuzlyphdke6j3co5htdkgbgwkss3zuqd.onion is down. Checked 1 day ago.
hello, anon.
iczkh5negmomr4fgzrmw7atfstvsksscssitnzhlneurgmueqm6ddrqd.onion is down. Checked 17 hours ago.
Anonymous Files: Free File Upload Service for Clearnet & Tor AnonymousFiles
kqdrhdqaqeqc3txz7uekmesz3ny6rut477657gf2y5tnwkya7nv65pid.onion is down. Checked 1 day ago.
Tor Channel
kofzd2fnugm2x45kakux53phx25nswnfk4wqortvhemofewzaoutyjqd.onion is down. Checked 1 day ago.
Tor Sözlük - anonim bilgi kaynağı
kokfg4q5vhgdwxkji73bwk3ee7gpatpbevvewi3ijwzcmphqmxutq4id.onion is down. Checked 19 hours ago.
Excavator - search in darknet
ktg4ju5yvcfg6hndidkbhouqy6x4yivtrvvd6jqi2ucfpti5bpwgjnid.onion is down. Checked 23 hours ago.
Verifo Financial Services - Amazon Gift Cards & Western Money Order
ktih-4cyd.onion is down. Checked 1 day ago.
Agora 🧅 Explore The Deepweb - Agora - Onion links
koin-nnad.onion is down. Checked 1 day ago.
Porn and Erotic - Porn Market | Dark web links
kvcg-qtad.onion is down. Checked 1 day ago.
Best Darknet Marketplace - Verified since 2019 - Torpex Market
l7ju-jyad.onion is down. Checked 21 hours ago.
Liberal | Onion Directory
libe-7gyd.onion is down. Checked 1 day ago.
Ares Link Portal
link-gdid.onion is down. Checked 22 hours ago.
Tor Hidden Service Directory Wiki Links
linkeripwarjedubvsiojvbvqheisatakhksi23gsux3pwpa4en74cid.onion is down. Checked 1 day ago.
TOR VERIFIED
link-zwad.onion is down. Checked 13 minutes ago.
TPPP's topic links
links3l2agydp5ouogd5lfldjuuz7cotqsj26fx4newxtnfz2smw7qqd.onion is down. Checked 1 day ago.
Links Dir
link-faqd.onion is down. Checked 1 day ago.
Link List
list-szyd.onion is down. Checked 1 day ago.
Latest Sites Checked
hyzmpq2fg4x7jrhyeap4kruohxs6owkbxeebnropoarlq6kfmcjnuaqd.onion - Dopassic Park – Where dope is as big as dinosaurs
Server is up.
Last checked 28 seconds ago.
anowddbdpl7d4mo2ovi72e6llulp47qr6h6hgrvd44dv7fc56hu6ytyd.onion - ANOW — Anonymous Crypto Escrow Platform
Server is up.
Last checked 32 seconds ago.
Server is up.
Last checked 51 seconds ago.
Server is up.
Last checked 55 seconds ago.
goodxijl5myiqnxmrq76lzhc4buu3aee4frbnt76nsa24ytgkuw25qyd.onion - Agora road Marketplace – best onion market - agora road mark ...
Server is up.
Last checked 1 minute ago.
Server is up.
Last checked 1 minute ago.
Server is up.
Last checked 1 minute ago.
bvten5sviu2xvdgxo2zjxebqajq7qv7mdvsddzh4czso6rdpwtclokad.onion - Beneath VT – Exploring Virginia Tech's steam tunnels and bey ...
Server is up.
Last checked 1 minute ago.
btc75f5yfeul6nwwzua2vyyfrqksnfqiby4vjfo57d4lqqit4rernxid.onion - Bitcoin Wallet | Buy Bitcoin Wallets 2026
Server is up.
Last checked 2 minutes ago.
ahzwqc5tkj6yoyndadl4aajoi76zgxwklrr6zwlf2xi3od6rdodn42qd.onion - Stolen Cryptocurrency Wallets
Server is up.
Last checked 2 minutes ago.
Down Right Now
nnr2divekgyallk2v2gvv677snlpc2kh6eoasxr7q3zq56kcukdmhjyd.onion - Cloned cards buy � CLONED CARDS WITH PIN
Server is down.
Last checked 17 seconds ago.
nullmesrll647fi66mt6emm4ujbdctlkywfwkqghrdhacewawceittad.onion - NULL Message - Self-destructed encrypted messages
Server is down.
Last checked 21 seconds ago.
nlg6nueddb7bz66s5uwiny4zwsjxj3xnsje2zmvtyhjyyson42a6rgid.onion - Credit Card Dumps - PayPal transfer BTC
Server is down.
Last checked 24 seconds ago.
bh2r53z4y6oy46pwbz4ujfi6qmnaz6pv6ng6cqjp7gday277jzcu5uid.onion - Site hosted by Daniel's sdfs fsd hosting service
Server is down.
Last checked 25 seconds ago.
hosting2t672fmnylbc5t7wz6zksjdwolv7xspinatyylriiv6giadad.onion - Hostings accepting cryptocurrency payments
Server is down.
Last checked 26 seconds ago.
bh3ixcdsub6eezlpnpchzofrqao37ljvc2dv366qlvgmyhafeiyyvcad.onion - Site hosted by giel's hosting service
Server is down.
Last checked 29 seconds ago.
Server is down.
Last checked 30 seconds ago.
Server is down.
Last checked 31 seconds ago.
Server is down.
Last checked 38 seconds ago.
Server is down.
Last checked 38 seconds ago.