Check It Onion ?
"Check It Onion" monitors the status of your favorite web sites and checks whether they are down or not. Check a website status easily by using the below test tool. Just enter the url and a fresh site status test will be performed on the domain name in real time using our online website checker tool.
To ensure your privacy and security, the Tor Browser is recommended for visiting this website. You can download the Tor Browser by visiting torproject.org. After installing the Tor Browser, copy the onion address below to continue visiting the "Check It Onion" website.
Check It Onion address: http://checkitzh2q35xf42lrtxc6a4o2aqpvvu5dpdophhl44rnqla7ffpkid.onion
Enter a keyword or domain below to check whether it is down or not...
Search Result - Tor verified links | Link directory
Send us your Briar Link
gg7ccyx6ajzs333azm2kwoxhlnixbcjmylogilsqaxncqjyqfhbf4xqd.onion is down. Checked 1 day ago.
Excavator - search in darknet
gfwzwfjvpisdjunsqk3txrhr6ruiwz6p4yk54s3a4twmc53lm4yieoyd.onion is down. Checked 1 day ago.
Excavator - search in darknet
gfxlrtm7jdzomt2zt7ewoxb5l2dl4a6zdqilq6eqvfgluo3fu3rbkmad.onion is down. Checked 1 day ago.
Hola usuario de Tor
gghhublalbhwv535c3yux6jahcl6cyfodpgsujsislx46kg3phid4sad.onion is down. Checked 1 day ago.
Link Directory Pro
gi2m-2zad.onion is down. Checked 19 hours ago.
Excavator - search in darknet
gi74ubm5453rcitrlcu3e4abm2ntsbpj56f5iobvmxw7mkph4mg6y7id.onion is down. Checked 1 day ago.
Onion Link Directory | Adult, porn, CP, Pedo
gnh2-osyd.onion is down. Checked 1 day ago.
Webpage archive
grpvepcglysm47qican3qaaiffjzgjg753qzqppgqmsj5jrvona7wwad.onion is down. Checked 1 day ago.
Illegal Hacking Services | GhostSquad
ghos-akqd.onion is down. Checked 16 minutes ago.
Hacker Links
gijuktdzvczm7dkaasvlxfdzdigwobd5a4kvzvekklshzkxq6g4kjuqd.onion is down. Checked 16 hours ago.
Hidden Wiki Tor Links Catalog onion sites
gwp5-6dqd.onion is down. Checked 23 hours ago.
Excavator - search in darknet
gu335cohs3wo6lezifheh4qdx4nz2dqkctszan3nwuljsgnbjsc6fzid.onion is down. Checked 20 hours ago.
GUN CITY - PISTOLS RIFLES MACHINE GUNS
gunc-xxyd.onion is down. Checked 1 day ago.
Excavator - search in darknet
gjwxiqvcjq4bi3mew5b55hxekgmtiiay7k2peqz66xeudutskzplvfqd.onion is down. Checked 17 hours ago.
Excavator - search in darknet
giu7cn33yfxpqrjzkakuzanhbgxlczadyvrz6lgyvrzndpdmmidafzid.onion is down. Checked 1 day ago.
Live Onion Miner, Tor Roadmap, Deepweb directory
gimpydtor2g4wfelfttr5lak25uzvtndfn7gbjq6alft32wxkiqc34yd.onion is down. Checked 22 hours ago.
(Untitled)
gjtk3ipdpxdabqfhifzrumrlfidtorayzhmatfebxsg4zb4w6xtkbryd.onion is down. Checked 19 hours ago.
GLOCK MARKET | BUY GUNS AND AMMO ON TOR | GLOCK | COLT | BERETTA
gmar-4eqd.onion is down. Checked 7 hours ago.
(Untitled)
g6wyzutp3akcoq2gtorkitxvexmteoeomdednztjcv2yytdjs5b2q5yd.onion is down. Checked 1 day ago.
Directory of verified sites
g2mx-fmqd.onion is down. Checked 20 hours ago.
Latest Sites Checked
hyzmpq2fg4x7jrhyeap4kruohxs6owkbxeebnropoarlq6kfmcjnuaqd.onion - Dopassic Park – Where dope is as big as dinosaurs
Server is up.
Last checked 31 seconds ago.
anowddbdpl7d4mo2ovi72e6llulp47qr6h6hgrvd44dv7fc56hu6ytyd.onion - ANOW — Anonymous Crypto Escrow Platform
Server is up.
Last checked 35 seconds ago.
Server is up.
Last checked 54 seconds ago.
Server is up.
Last checked 58 seconds ago.
goodxijl5myiqnxmrq76lzhc4buu3aee4frbnt76nsa24ytgkuw25qyd.onion - Agora road Marketplace – best onion market - agora road mark ...
Server is up.
Last checked 1 minute ago.
Server is up.
Last checked 1 minute ago.
Server is up.
Last checked 1 minute ago.
bvten5sviu2xvdgxo2zjxebqajq7qv7mdvsddzh4czso6rdpwtclokad.onion - Beneath VT – Exploring Virginia Tech's steam tunnels and bey ...
Server is up.
Last checked 2 minutes ago.
btc75f5yfeul6nwwzua2vyyfrqksnfqiby4vjfo57d4lqqit4rernxid.onion - Bitcoin Wallet | Buy Bitcoin Wallets 2026
Server is up.
Last checked 2 minutes ago.
ahzwqc5tkj6yoyndadl4aajoi76zgxwklrr6zwlf2xi3od6rdodn42qd.onion - Stolen Cryptocurrency Wallets
Server is up.
Last checked 2 minutes ago.
Down Right Now
nnr2divekgyallk2v2gvv677snlpc2kh6eoasxr7q3zq56kcukdmhjyd.onion - Cloned cards buy � CLONED CARDS WITH PIN
Server is down.
Last checked 20 seconds ago.
nullmesrll647fi66mt6emm4ujbdctlkywfwkqghrdhacewawceittad.onion - NULL Message - Self-destructed encrypted messages
Server is down.
Last checked 24 seconds ago.
nlg6nueddb7bz66s5uwiny4zwsjxj3xnsje2zmvtyhjyyson42a6rgid.onion - Credit Card Dumps - PayPal transfer BTC
Server is down.
Last checked 27 seconds ago.
bh2r53z4y6oy46pwbz4ujfi6qmnaz6pv6ng6cqjp7gday277jzcu5uid.onion - Site hosted by Daniel's sdfs fsd hosting service
Server is down.
Last checked 28 seconds ago.
hosting2t672fmnylbc5t7wz6zksjdwolv7xspinatyylriiv6giadad.onion - Hostings accepting cryptocurrency payments
Server is down.
Last checked 29 seconds ago.
bh3ixcdsub6eezlpnpchzofrqao37ljvc2dv366qlvgmyhafeiyyvcad.onion - Site hosted by giel's hosting service
Server is down.
Last checked 32 seconds ago.
Server is down.
Last checked 33 seconds ago.
Server is down.
Last checked 34 seconds ago.
Server is down.
Last checked 41 seconds ago.
Server is down.
Last checked 41 seconds ago.