Check It Onion ?
"Check It Onion" monitors the status of your favorite web sites and checks whether they are down or not. Check a website status easily by using the below test tool. Just enter the url and a fresh site status test will be performed on the domain name in real time using our online website checker tool.
To ensure your privacy and security, the Tor Browser is recommended for visiting this website. You can download the Tor Browser by visiting torproject.org. After installing the Tor Browser, copy the onion address below to continue visiting the "Check It Onion" website.
Check It Onion address: http://checkitzh2q35xf42lrtxc6a4o2aqpvvu5dpdophhl44rnqla7ffpkid.onion
Enter a keyword or domain below to check whether it is down or not...
Search Result - Onion Sites - Directory
(Untitled)
vf7vsrexwb7e4j65idp4hq4eqlvjiwrnvi3jnb4st7oteer5tzgvhaqd.onion is up. Checked 1 day ago.
The Hidden Market - Home
vice-utid.onion is up. Checked 4 hours ago.
Blender.io Bitcoin tumbler service, Secure and Anonymous Bitcoin Mixer
vi7z-ivid.onion is down. Checked 10 hours ago.
(Untitled)
vice2rsunli3mauak6wppu4poycjco4aj4h7rcgmf7p6eyiqzywxglid.onion is down. Checked 18 hours ago.
Vice City Market
vice-jayd.onion is up. Checked 1 day ago.
Plastic Market
vkjn-iuyd.onion is up. Checked 14 hours ago.
(Untitled)
vmod5lxalqu4qkp2hgdghlpsyg2cafhooau3e3j5hh5tt4renfnfacid.onion is down. Checked 1 day ago.
Trusted Credit Cards Vendor
vx7r-4qqd.onion is up. Checked 15 hours ago.
Welcome | Norddeutscher Rundfunk (NDR) | SecureDrop
vxemae5nujorg6hicdba5dzz6kxooler5e5wffd4hymrqd26yapc4oqd.onion is up. Checked 10 hours ago.
The END ! .:.Dark/Black Magic.:.
vwz3-jlyd.onion is up. Checked 14 hours ago.
ShopsDir - New Hidden Shops Directory
vxmu-i4qd.onion is up. Checked 9 hours ago.
grimszzz
wcbb3e3yzsnx7tb6inwpddywxeapbytpffe233htys2qr54tp6qrkaqd.onion is down. Checked 1 day ago.
(Untitled)
wcafvovpekwy6sgicjx3jqdaieytawkip4cd7q3mgsarwkwglvntzpyd.onion is up. Checked 16 hours ago.
Seirdy’s Home
wgq3-rkyd.onion is up. Checked 12 hours ago.
Wolf Hacker Group - Bank & Western Union Hacking - Cloned ATM Cards - Dumps with PIN
whac-z3yd.onion is up. Checked 1 day ago.
Whatsapp Account Hack
what-qpad.onion is up. Checked 4 hours ago.
INDST Search
wher-2mad.onion is up. Checked 20 hours ago.
White House Market - Home
whm2fsi3ljgmhr7uxaepg2ywqgiinm4s52ln5nsbhis2w4jsfhkoawad.onion is up. Checked 5 hours ago.
***Bitcoin The Quantum Miner***
whmj-hjad.onion is up. Checked 2 hours ago.
(Untitled)
whmjkybclry22tbex7lgjqrxshwpszgq6px6wf6rzmutuinmxmtjuaad.onion is up. Checked 5 hours ago.
Latest Sites Checked
hyzmpq2fg4x7jrhyeap4kruohxs6owkbxeebnropoarlq6kfmcjnuaqd.onion - Dopassic Park – Where dope is as big as dinosaurs
Server is up.
Last checked 32 seconds ago.
anowddbdpl7d4mo2ovi72e6llulp47qr6h6hgrvd44dv7fc56hu6ytyd.onion - ANOW — Anonymous Crypto Escrow Platform
Server is up.
Last checked 36 seconds ago.
Server is up.
Last checked 55 seconds ago.
Server is up.
Last checked 59 seconds ago.
goodxijl5myiqnxmrq76lzhc4buu3aee4frbnt76nsa24ytgkuw25qyd.onion - Agora road Marketplace – best onion market - agora road mark ...
Server is up.
Last checked 1 minute ago.
Server is up.
Last checked 1 minute ago.
Server is up.
Last checked 1 minute ago.
bvten5sviu2xvdgxo2zjxebqajq7qv7mdvsddzh4czso6rdpwtclokad.onion - Beneath VT – Exploring Virginia Tech's steam tunnels and bey ...
Server is up.
Last checked 2 minutes ago.
btc75f5yfeul6nwwzua2vyyfrqksnfqiby4vjfo57d4lqqit4rernxid.onion - Bitcoin Wallet | Buy Bitcoin Wallets 2026
Server is up.
Last checked 2 minutes ago.
ahzwqc5tkj6yoyndadl4aajoi76zgxwklrr6zwlf2xi3od6rdodn42qd.onion - Stolen Cryptocurrency Wallets
Server is up.
Last checked 2 minutes ago.
Down Right Now
nnr2divekgyallk2v2gvv677snlpc2kh6eoasxr7q3zq56kcukdmhjyd.onion - Cloned cards buy � CLONED CARDS WITH PIN
Server is down.
Last checked 21 seconds ago.
nullmesrll647fi66mt6emm4ujbdctlkywfwkqghrdhacewawceittad.onion - NULL Message - Self-destructed encrypted messages
Server is down.
Last checked 25 seconds ago.
nlg6nueddb7bz66s5uwiny4zwsjxj3xnsje2zmvtyhjyyson42a6rgid.onion - Credit Card Dumps - PayPal transfer BTC
Server is down.
Last checked 28 seconds ago.
bh2r53z4y6oy46pwbz4ujfi6qmnaz6pv6ng6cqjp7gday277jzcu5uid.onion - Site hosted by Daniel's sdfs fsd hosting service
Server is down.
Last checked 29 seconds ago.
hosting2t672fmnylbc5t7wz6zksjdwolv7xspinatyylriiv6giadad.onion - Hostings accepting cryptocurrency payments
Server is down.
Last checked 30 seconds ago.
bh3ixcdsub6eezlpnpchzofrqao37ljvc2dv366qlvgmyhafeiyyvcad.onion - Site hosted by giel's hosting service
Server is down.
Last checked 33 seconds ago.
Server is down.
Last checked 34 seconds ago.
Server is down.
Last checked 35 seconds ago.
Server is down.
Last checked 42 seconds ago.
Server is down.
Last checked 42 seconds ago.