Check It Onion ?

"Check It Onion" monitors the status of your favorite web sites and checks whether they are down or not. Check a website status easily by using the below test tool. Just enter the url and a fresh site status test will be performed on the domain name in real time using our online website checker tool.

To ensure your privacy and security, the Tor Browser is recommended for visiting this website. You can download the Tor Browser by visiting torproject.org. After installing the Tor Browser, copy the onion address below to continue visiting the "Check It Onion" website.

Check It Onion address: http://checkitzh2q35xf42lrtxc6a4o2aqpvvu5dpdophhl44rnqla7ffpkid.onion

Enter a keyword or domain below to check whether it is down or not...

Search Result - Onion Sites - Directory
DeepMart - Marketplace with Multisig Escrow System
vpir-tnyd.onion is up. Checked 3 hours ago.
Momentum
vfhn3vzvvh767fcu5l66kywdua62t5fwqjr2zrakiaq7b5hmkrb7riid.onion is up. Checked 3 hours ago.
(Untitled)
vgzswi7cnn3lajv2zqeoy7xbpvb4sgm2bylqhyfxxa5hpbodr7aoyiqd.onion is down. Checked 1 hour ago.
Home - Trusted Market
vgqz-ogad.onion is down. Checked 1 day ago.
Facebook account hacking
vjdl-i3yd.onion is up. Checked 10 hours ago.
Bitscrow
viju-74qd.onion is down. Checked 1 day ago.
6
vimg-joid.onion is down. Checked 3 hours ago.
صفحه در دست تعمیر
vljgmap2mmice6gddp4c5vvopnohyvmqjvcylmsul5edhhpjro7ovlad.onion is up. Checked 3 hours ago.
(Untitled)
venetorptvg2zjch4cgdx5kv2pn7clvozime4by3k726lhgvx6xizsad.onion is up. Checked 14 hours ago.
Marketplace Access Queue
veno-yjqd.onion is up. Checked 19 hours ago.
Venus Market
venu-wyqd.onion is up. Checked 11 hours ago.
Venom Software - Remote Administration Tools
veno-nnqd.onion is up. Checked 2 hours ago.
The Washington Post | SecureDrop
vfnmxpa6fo4jdpyq3yneqhglluweax2uclvxkytfpmpkp5rsl75ir5qd.onion is up. Checked 1 day ago.
Northern California Ford Owners - California's Ford Car Community
vo3z-o5ad.onion is up. Checked 3 hours ago.
Paypal Monster - We give opportunities
vo4h-3gid.onion is up. Checked 5 hours ago.
~vern
vern-zrad.onion is up. Checked 2 hours ago.
(Untitled)
videos3qfq2zcpz6nwywxpctbepza56w7x3uggkbnfkk2al6vfsw4tqd.onion is down. Checked 22 hours ago.
(Untitled)
videos3q7ez4z7ylyzlyy4beoshhwrmbo6gnnmiew3rj7j2tzlc4xyyd.onion is up. Checked 5 hours ago.
Cards&Transfers Shop – Buy cards & money transfers
view-ppyd.onion is up. Checked 2 hours ago.
Latest Sites Checked
hyzmpq2fg4x7jrhyeap4kruohxs6owkbxeebnropoarlq6kfmcjnuaqd.onion - Dopassic Park – Where dope is as big as dinosaurs
Server is up. Last checked 32 seconds ago.
anowddbdpl7d4mo2ovi72e6llulp47qr6h6hgrvd44dv7fc56hu6ytyd.onion - ANOW — Anonymous Crypto Escrow Platform
Server is up. Last checked 36 seconds ago.
Server is up. Last checked 55 seconds ago.
Server is up. Last checked 59 seconds ago.
goodxijl5myiqnxmrq76lzhc4buu3aee4frbnt76nsa24ytgkuw25qyd.onion - Agora road Marketplace – best onion market - agora road mark ...
Server is up. Last checked 1 minute ago.
Server is up. Last checked 1 minute ago.
Server is up. Last checked 1 minute ago.
bvten5sviu2xvdgxo2zjxebqajq7qv7mdvsddzh4czso6rdpwtclokad.onion - Beneath VT – Exploring Virginia Tech's steam tunnels and bey ...
Server is up. Last checked 2 minutes ago.
btc75f5yfeul6nwwzua2vyyfrqksnfqiby4vjfo57d4lqqit4rernxid.onion - Bitcoin Wallet | Buy Bitcoin Wallets 2026
Server is up. Last checked 2 minutes ago.
Server is up. Last checked 2 minutes ago.
Down Right Now
nnr2divekgyallk2v2gvv677snlpc2kh6eoasxr7q3zq56kcukdmhjyd.onion - Cloned cards buy � CLONED CARDS WITH PIN
Server is down. Last checked 21 seconds ago.
nullmesrll647fi66mt6emm4ujbdctlkywfwkqghrdhacewawceittad.onion - NULL Message - Self-destructed encrypted messages
Server is down. Last checked 25 seconds ago.
nlg6nueddb7bz66s5uwiny4zwsjxj3xnsje2zmvtyhjyyson42a6rgid.onion - Credit Card Dumps - PayPal transfer BTC
Server is down. Last checked 28 seconds ago.
bh2r53z4y6oy46pwbz4ujfi6qmnaz6pv6ng6cqjp7gday277jzcu5uid.onion - Site hosted by Daniel's sdfs fsd hosting service
Server is down. Last checked 29 seconds ago.
hosting2t672fmnylbc5t7wz6zksjdwolv7xspinatyylriiv6giadad.onion - Hostings accepting cryptocurrency payments
Server is down. Last checked 30 seconds ago.
bh3ixcdsub6eezlpnpchzofrqao37ljvc2dv366qlvgmyhafeiyyvcad.onion - Site hosted by giel's hosting service
Server is down. Last checked 33 seconds ago.
Server is down. Last checked 34 seconds ago.
Server is down. Last checked 35 seconds ago.
Server is down. Last checked 42 seconds ago.
Server is down. Last checked 42 seconds ago.