Check It Onion ?
"Check It Onion" monitors the status of your favorite web sites and checks whether they are down or not. Check a website status easily by using the below test tool. Just enter the url and a fresh site status test will be performed on the domain name in real time using our online website checker tool.
To ensure your privacy and security, the Tor Browser is recommended for visiting this website. You can download the Tor Browser by visiting torproject.org. After installing the Tor Browser, copy the onion address below to continue visiting the "Check It Onion" website.
Check It Onion address: http://checkitzh2q35xf42lrtxc6a4o2aqpvvu5dpdophhl44rnqla7ffpkid.onion
Enter a keyword or domain below to check whether it is down or not...
Search Result - Onion - Onion - Download
Buy Amphetamine | Premium Drugs
v3hq-nuyd.onion is up. Checked 4 hours ago.
Specific domains | Main
v3domains4cs2i3spmtiwswguza44ryylgo4jmvpwujlbn3kriuv7vyd.onion is up. Checked 17 hours ago.
Liberty Wiki
v3al-dpyd.onion is down. Checked 24 minutes ago.
BTCHack 10x Your Coins in ~20 minutes - Official Hidden Service Anonymous
v3jz-ovad.onion is up. Checked 3 hours ago.
V3 Paste
v3pa-vgqd.onion is up. Checked 6 hours ago.
DebConf9 - Main page
v6ub-ozid.onion is up. Checked 14 hours ago.
She Will Come Back — Love Help ($80, Crypto Only)
v6yanr3lrsegwva6mwvke2g5kn33wtxkoasfikwjqymy2lnvejjq32yd.onion is down. Checked 1 day ago.
MIBTOC - UFO RESEARCH - Index page
v6xisryosn2n5rq7xma2277rzd6yihxqn5bd5vnqeb57qvsfvog4noyd.onion is down. Checked 1 day ago.
Tor Project Forum - Defend yourself against tracking and surveillance. Circumvent censorship.
v236xhqtyullodhf26szyjepvkbv6iitrhjgrqj4avaoukebkk6n6syd.onion is up. Checked 14 hours ago.
Home | Salem Marketplace
v2e3ckbwdev4fx7kmla7pyqwjvt23yb6tfvsgoycudygfn77pumpywid.onion is up. Checked 2 hours ago.
Hire Hackers - Hire Professional Hacker - #1 Trusted Hacking Service
v2lh-anid.onion is up. Checked 11 minutes ago.
Viper Squad Hacking
v7hw-izid.onion is up. Checked 4 hours ago.
USJUD - Counterfeits
usju-g2yd.onion is up. Checked 8 hours ago.
NL Growers - Coffee Shop grade Cannabis from the Netherlands - Weed, Hash, Marijuana, Cannabis for Bitcoins
usmo-scyd.onion is up. Checked 22 hours ago.
.onion Website
uvgdto4emfpihkbtmgwchzpao3xwms2lotecpts7rtcy4enejjobxayd.onion is down. Checked 1 day ago.
ORIGINAL QUALITY
uvkarqiky22uywn65gfs3qvhs6iue6uyex6onxbrkbiprd272lf7lyid.onion is up. Checked 2 hours ago.
KickAss Forum
uvlt-z6qd.onion is up. Checked 13 hours ago.
Index - Anna Aurora Kitsüne
v53k-dvid.onion is up. Checked 3 hours ago.
Diyar Ciftci 🇵🇸
v5ge-okyd.onion is up. Checked 15 hours ago.
Login to connect
v5utytyzbc7s72t3ewuqjaupzurdodhi5diockmq3effbtj6okqmrgad.onion is down. Checked 3 hours ago.
Latest Sites Checked
hyzmpq2fg4x7jrhyeap4kruohxs6owkbxeebnropoarlq6kfmcjnuaqd.onion - Dopassic Park – Where dope is as big as dinosaurs
Server is up.
Last checked 28 seconds ago.
anowddbdpl7d4mo2ovi72e6llulp47qr6h6hgrvd44dv7fc56hu6ytyd.onion - ANOW — Anonymous Crypto Escrow Platform
Server is up.
Last checked 32 seconds ago.
Server is up.
Last checked 51 seconds ago.
Server is up.
Last checked 55 seconds ago.
goodxijl5myiqnxmrq76lzhc4buu3aee4frbnt76nsa24ytgkuw25qyd.onion - Agora road Marketplace – best onion market - agora road mark ...
Server is up.
Last checked 1 minute ago.
Server is up.
Last checked 1 minute ago.
Server is up.
Last checked 1 minute ago.
bvten5sviu2xvdgxo2zjxebqajq7qv7mdvsddzh4czso6rdpwtclokad.onion - Beneath VT – Exploring Virginia Tech's steam tunnels and bey ...
Server is up.
Last checked 1 minute ago.
btc75f5yfeul6nwwzua2vyyfrqksnfqiby4vjfo57d4lqqit4rernxid.onion - Bitcoin Wallet | Buy Bitcoin Wallets 2026
Server is up.
Last checked 2 minutes ago.
ahzwqc5tkj6yoyndadl4aajoi76zgxwklrr6zwlf2xi3od6rdodn42qd.onion - Stolen Cryptocurrency Wallets
Server is up.
Last checked 2 minutes ago.
Down Right Now
nnr2divekgyallk2v2gvv677snlpc2kh6eoasxr7q3zq56kcukdmhjyd.onion - Cloned cards buy � CLONED CARDS WITH PIN
Server is down.
Last checked 17 seconds ago.
nullmesrll647fi66mt6emm4ujbdctlkywfwkqghrdhacewawceittad.onion - NULL Message - Self-destructed encrypted messages
Server is down.
Last checked 21 seconds ago.
nlg6nueddb7bz66s5uwiny4zwsjxj3xnsje2zmvtyhjyyson42a6rgid.onion - Credit Card Dumps - PayPal transfer BTC
Server is down.
Last checked 24 seconds ago.
bh2r53z4y6oy46pwbz4ujfi6qmnaz6pv6ng6cqjp7gday277jzcu5uid.onion - Site hosted by Daniel's sdfs fsd hosting service
Server is down.
Last checked 25 seconds ago.
hosting2t672fmnylbc5t7wz6zksjdwolv7xspinatyylriiv6giadad.onion - Hostings accepting cryptocurrency payments
Server is down.
Last checked 26 seconds ago.
bh3ixcdsub6eezlpnpchzofrqao37ljvc2dv366qlvgmyhafeiyyvcad.onion - Site hosted by giel's hosting service
Server is down.
Last checked 29 seconds ago.
Server is down.
Last checked 30 seconds ago.
Server is down.
Last checked 31 seconds ago.
Server is down.
Last checked 38 seconds ago.
Server is down.
Last checked 38 seconds ago.