Check It Onion ?
"Check It Onion" monitors the status of your favorite web sites and checks whether they are down or not. Check a website status easily by using the below test tool. Just enter the url and a fresh site status test will be performed on the domain name in real time using our online website checker tool.
To ensure your privacy and security, the Tor Browser is recommended for visiting this website. You can download the Tor Browser by visiting torproject.org. After installing the Tor Browser, copy the onion address below to continue visiting the "Check It Onion" website.
Check It Onion address: http://checkitzh2q35xf42lrtxc6a4o2aqpvvu5dpdophhl44rnqla7ffpkid.onion
Enter a keyword or domain below to check whether it is down or not...
Search Result - Facebook – log in or sign up
TorMart - Multisig Escrow Marketplace
deep-3eqd.onion is up. Checked 8 hours ago.
deepr - where the deep web connects
deeprecyrsonacndoosu3udqp7ziofjddoiq6grsfizp3m3mvbiinpad.onion is up. Checked 6 hours ago.
İndex
deeptr7jzltz5ua7gyfvorvhwcvgvw6zfqexs26u5yx446yfedpf46yd.onion is down. Checked 1 day ago.
Main page
doma-byqd.onion is up. Checked 8 hours ago.
DoubleBitcoin – Double Your BTC in 24 Hours
doublem7w7rtu3pn73un52qo2s7ev5nq33irtjusahmwym7z7dsmzbad.onion is up. Checked 7 hours ago.
French Deep
dosg2qw5cgvd53lheimyusozf6in5bqzgoy3r6rlq7xecxsya2xxspid.onion is down. Checked 1 day ago.
Buy Guns Online Anonymously With Cryptocurrency and Bitcoin
dprd-wvid.onion is up. Checked 22 hours ago.
Buy Guns Online Anonymously With Cryptocurrency and Bitcoin
dprd-7fad.onion is up. Checked 6 hours ago.
Main page
domarktjuex7zyerizc4yc7up3lwudj2366utxdwpaqqj2gvg4oqclid.onion is up. Checked 11 hours ago.
Little Angel
dpa7-5ryd.onion is up. Checked 3 hours ago.
Shop - Buy Fake USD Online - Counterfeit Money For Sale In USA
dp4d-gtid.onion is down. Checked 1 day ago.
Little Angel
dpa7-inyd.onion is up. Checked 2 hours ago.
(Untitled)
doxbin2bde3fikvxzxv6l54cqbahecne6urf6lhr3qzpdpvgihalsnad.onion is up. Checked 23 hours ago.
Frontpage - Dread
dreadytu5e57d2xyx2fdgpvqnaf7zxhwr65k5vozpfbotulgv46lc7id.onion is up. Checked 8 hours ago.
Drug Hub - darknet drugs marketplace
drug-s7yd.onion is up. Checked 1 day ago.
DarknetDir - Verified Tor Markets Directory 2026
drkndrhvrvr3xbm2lzur2nv5ew5625azdixrunhb6incu5oy6tykg5ad.onion is up. Checked 4 hours ago.
(Untitled)
drrdoi4eeb6iugxevqe22cfkqiqzmf7jlr5udmlf67ofina74s42khid.onion is up. Checked 1 day ago.
Shop
drugsh2bses22nezh2ahvdkd2aiw56i6vgcoml2ajdsaqywb2uczhead.onion is down. Checked 1 day ago.
Small Chicks & Boys
ds6a-2gad.onion is up. Checked 11 hours ago.
Buy Guns Online Anonymously With Cryptocurrency and Bitcoin
dsvi-gbad.onion is up. Checked 9 hours ago.
Latest Sites Checked
iu2fjxppm42o7syucbtdi4nlf544lx3a7ogd2mgh33uls4r5zlgg4nqd.onion - Store Cards - buy cloned card
Server is up.
Last checked 22 seconds ago.
Server is up.
Last checked 42 seconds ago.
eoill6xoeysx6xvynwxpkogstp72q5i4splrci62ayyqnw3i4z746oyd.onion - Drug Emporium
Server is up.
Last checked 43 seconds ago.
pflujznptk5lmuf6xwadfqy6nffykdvahfbljh7liljailjbxrgvhfid.onion - Onion Mail — Anonymous Encrypted Email | ProtonMail & Tuta A ...
Server is up.
Last checked 1 minute ago.
carddumdyjfyxbi6hrcm6q6d3melw3slymumfeny2fc4ldsirlrusxid.onion - 21 Dump Street
Server is up.
Last checked 4 minutes ago.
walletors3djwdek6hcpmcyqje5mgx34dkl77gfivld76bb4won3pjad.onion - Bitcoin Onion Wallet
Server is up.
Last checked 4 minutes ago.
Server is up.
Last checked 4 minutes ago.
huupank42eulnaeb7gartdz3b24chgepyps5cfxrlygcfqdf33wl7fqd.onion - LinkyWay | SEO-focused link directory
Server is up.
Last checked 4 minutes ago.
bvrgrzu5awjacohape5s6s3j2locltcu5c7azzzuufqznknus5ll5fid.onion - unidentified instance
Server is up.
Last checked 5 minutes ago.
onion5qv5g3kp2n644yrrt46d3uxgbqb5de5yixjexwd4wbwwzalbdqd.onion - Onionbase | Verified deep web sites
Server is up.
Last checked 7 minutes ago.
Down Right Now
j4otbmdbfb6e6n7dmio3co63txkeh3pgr5k2gmxccivewplkaahwl6ad.onion - BITCARDS - Prepaid cards
Server is down.
Last checked 12 seconds ago.
Server is down.
Last checked 13 seconds ago.
nullmesrll647fi66mt6emm4ujbdctlkywfwkqghrdhacewawceittad.onion - NULL Message - Self-destructed encrypted messages
Server is down.
Last checked 13 seconds ago.
o3xmepak6ag7hj6icjy7maikojicafunke4fpol4g3ctr6jhpmp2k6id.onion - [ + ] - Darkwave Ops Team
Server is down.
Last checked 21 seconds ago.
Server is down.
Last checked 40 seconds ago.
j7xbwxag3fxd2g3n5g3goyceozdianughur2uvs3j52rivha437u3wyd.onion - #1 .First Foot W0RSH1P Academy
Server is down.
Last checked 1 minute ago.
skmg22laeh4ttqs55kpr7frlaysg53qjvpa667m5vlikublgjqcfd7qd.onion - Hacking Team - On Deepweb Since 2014 - [email protected] ...
Server is down.
Last checked 1 minute ago.
Server is down.
Last checked 1 minute ago.
4bzpe2ckeaw24tccka2a2ybhvycrkcvodkxp4thzstw7wli377sa7kqd.onion - [TorBox] The Tor Mail Box
Server is down.
Last checked 2 minutes ago.
22whawegoyoy7uur6xwyd632nglgkw652vkimxbgbxiqz7kq3kx2b6yd.onion - WhatsApp - Get a chat backup of any number
Server is down.
Last checked 2 minutes ago.