Check It Onion ?
"Check It Onion" monitors the status of your favorite web sites and checks whether they are down or not. Check a website status easily by using the below test tool. Just enter the url and a fresh site status test will be performed on the domain name in real time using our online website checker tool.
To ensure your privacy and security, the Tor Browser is recommended for visiting this website. You can download the Tor Browser by visiting torproject.org. After installing the Tor Browser, copy the onion address below to continue visiting the "Check It Onion" website.
Check It Onion address: http://checkitzh2q35xf42lrtxc6a4o2aqpvvu5dpdophhl44rnqla7ffpkid.onion
Enter a keyword or domain below to check whether it is down or not...
Search Result - Money 4 Money
Deep Wiki TOR Guide - The way into the Darknet and verified websites
guid-xsad.onion is up. Checked 23 hours ago.
GunCAD Index
-
A search engine for guns
gunindex33slornqta4ibyk7kti2fn75weanp63ijlrgzslmxcnsyayd.onion is up. Checked 5 hours ago.
Little Angel
gula-7xyd.onion is up. Checked 23 hours ago.
DID - DARK INVESTIGATION DEPT.
gulz-4jqd.onion is up. Checked 5 hours ago.
Plastic Marketplace
guk3-ysyd.onion is up. Checked 4 hours ago.
bunsbooru
gukf243tudw2fjbotoh5fmno46tppdsqjnod2dpmm4y5hayny4pnqzqd.onion is down. Checked 11 hours ago.
Little Angel
g7sn-czad.onion is up. Checked 8 hours ago.
Gabe Rocks!
gabr-msqd.onion is up. Checked 16 hours ago.
remember lads, subscribe to pewdiepie
gabu-erqd.onion is up. Checked 10 hours ago.
Gabe Rocks!
gabriel2or575b2cgstxqvxqn4lgi3jjfumm7p25fdidleposs2nmtyd.onion is up. Checked 17 hours ago.
(Untitled)
gagv-u6ad.onion is up. Checked 1 minute ago.
GainzAlgo | The Best Trading Algo
gainzalgmneoavpccqpsymjab4tb3zc2vkvwxxhu5mauk5bzak6fxdad.onion is up. Checked 19 minutes ago.
Welcome : Galaxy4
gala-ixid.onion is up. Checked 4 hours ago.
Gamer Uprising Forums
gamerupk4umcecwlkn2kh7dej7yq3vagpnp5o5jywjls6epalamj54ad.onion is up. Checked 2 hours ago.
Ganja Dir
ganjakaxxxlsu4dcejpcay22ygybwi7llj4dalhkud5eqffau5glpjid.onion is up. Checked 1 hour ago.
Isaac Ganoung's Website
ganoungg7wazgsuhcpn2k5otj4ubj2fegi3hhbsxxk4ky4dzlogpx3yd.onion is up. Checked 1 hour ago.
Fresh Pharma-Trusted Drugs Store
gjst-3yqd.onion is up. Checked 35 minutes ago.
Torture Room Videos
gjdu-jkyd.onion is up. Checked 4 hours ago.
Girling — latest posts
girlingof25b55nuxc6ucuslsrxitbyhfj7idpdk35lekvda4wsvtmyd.onion is up. Checked 3 hours ago.
BUY DRUGS
gjtre7uc7cdn6uyt35x73pvfpm5xfhfe2mk3th26g4wbsiwznghtnwqd.onion is down. Checked 19 hours ago.
Latest Sites Checked
black3gnkizshuynieigw6ejgpblb53mpasftzd6pydqpmq2vn2xf6yd.onion - Blackout Gateway
Server is up.
Last checked 41 seconds ago.
dc4nwiijwiffwztwzj5fngmcoppedrxg4jqj2tq67ontbini6qmlguid.onion - Data Keeper - Main page
Server is up.
Last checked 1 minute ago.
awazonhndi7e5yfaobpk7j2tsnp4kfd2xa63tdtzcg7plc5fka4il4ad.onion - Awazon Market - Access Queue
Server is up.
Last checked 1 minute ago.
iu2fjxppm42o7syucbtdi4nlf544lx3a7ogd2mgh33uls4r5zlgg4nqd.onion - Store Cards - buy cloned card
Server is up.
Last checked 1 minute ago.
Server is up.
Last checked 1 minute ago.
eoill6xoeysx6xvynwxpkogstp72q5i4splrci62ayyqnw3i4z746oyd.onion - Drug Emporium
Server is up.
Last checked 1 minute ago.
pflujznptk5lmuf6xwadfqy6nffykdvahfbljh7liljailjbxrgvhfid.onion - Onion Mail — Anonymous Encrypted Email | ProtonMail & Tuta A ...
Server is up.
Last checked 2 minutes ago.
carddumdyjfyxbi6hrcm6q6d3melw3slymumfeny2fc4ldsirlrusxid.onion - 21 Dump Street
Server is up.
Last checked 5 minutes ago.
walletors3djwdek6hcpmcyqje5mgx34dkl77gfivld76bb4won3pjad.onion - Bitcoin Onion Wallet
Server is up.
Last checked 5 minutes ago.
Server is up.
Last checked 5 minutes ago.
Down Right Now
whoisuieslzskvfjv6bcj4jwnwih3jpz2eeglzuqgwodr2edac3jckad.onion - WHOIS Lookup Tool
Server is down.
Last checked 36 seconds ago.
whclub624vdk5uyruesrvge2tlz5bxxmw67uihjghuetyxk5k3gfmsad.onion - WeedHouseClub
Server is down.
Last checked 45 seconds ago.
sgkddnvjs5xrigkf6kzc2aitgjwaljni3fkluklxa57fzptlfdrqtjyd.onion - The Retailer Original
Server is down.
Last checked 47 seconds ago.
7gaznhqj7ikqv4eq3kjguyou3rua42isokkeybfb7coj32l5irdlfuqd.onion - PrivateBin - Secured.fi
Server is down.
Last checked 51 seconds ago.
6n3y4j5veubfmber2vxow36nqs4whfwgrhp7i4ce2r7jzc2hrjzq2jad.onion - Hacked By Sipahiler
Server is down.
Last checked 1 minute ago.
Server is down.
Last checked 1 minute ago.
asyny4wop35br2gvj5vdfvqpso2hzabh5qxasy5tjumr5hm3juy5payd.onion - LinkList v4.0
Server is down.
Last checked 1 minute ago.
j4otbmdbfb6e6n7dmio3co63txkeh3pgr5k2gmxccivewplkaahwl6ad.onion - BITCARDS - Prepaid cards
Server is down.
Last checked 1 minute ago.
Server is down.
Last checked 1 minute ago.
nullmesrll647fi66mt6emm4ujbdctlkywfwkqghrdhacewawceittad.onion - NULL Message - Self-destructed encrypted messages
Server is down.
Last checked 1 minute ago.