Check It Onion ?

"Check It Onion" monitors the status of your favorite web sites and checks whether they are down or not. Check a website status easily by using the below test tool. Just enter the url and a fresh site status test will be performed on the domain name in real time using our online website checker tool.

To ensure your privacy and security, the Tor Browser is recommended for visiting this website. You can download the Tor Browser by visiting torproject.org. After installing the Tor Browser, copy the onion address below to continue visiting the "Check It Onion" website.

Check It Onion address: http://checkitzh2q35xf42lrtxc6a4o2aqpvvu5dpdophhl44rnqla7ffpkid.onion

Enter a keyword or domain below to check whether it is down or not...

Search Result - Dark Matter Project – DarkNet DeepWeb Tor Onion News Links I ...
(Untitled)
53g2pdjqqx7zu7elcjtsewukb7nsn6p7lfci2nbbefqnkgygohaqvwid.onion is down. Checked 1 day ago.
Little Angel
4zs4-vmyd.onion is up. Checked 10 hours ago.
GiftCardXpress - Buy Cheap Gift Cards
4ztj-jaad.onion is up. Checked 6 hours ago.
Hire A Hacker Service | Hack Spouse WhatsApp
5jc6efvvxwq6ugdyd25bx7prurtv2gxm3fsel5drkflhklfgrgdlzyid.onion is down. Checked 2 hours ago.
Team Facha 🥇 Elegidos por la gracia de Dios
5lrc3vjfxveiujwknjeofsqgrtsjc2irntd3xbnht5gvqfelf73t4dyd.onion is up. Checked 1 hour ago.
unique_opportunities
5lsy-thyd.onion is down. Checked 9 hours ago.
\\\ MUD
5pf6-4sad.onion is down. Checked 16 hours ago.
Little Angel
5p45-oxid.onion is up. Checked 10 hours ago.
Debian Reunion Hamburg 2022
5pyzapaecfrn5vvjzyygp5jhe4ciuugbeba3kqah7ycdddnpt3frpryd.onion is up. Checked 10 hours ago.
Index of /
5q3l-qlqd.onion is up. Checked 2 hours ago.
Safe PayPal Transfers
5syl2qgmcnjc23645bgdb6jei7cq3t4x53ts6oskbanfetmexgsshzid.onion is up. Checked 8 hours ago.
Little Angel
5ttw-4syd.onion is up. Checked 10 hours ago.
✅CHILD TOP VIDEO✅
5gaz-xiqd.onion is up. Checked 6 hours ago.
PayPal Expert | Premium Financial Services
5gmuuwkt52hfkqvzxqg4ajq2op2tcdqj2opsghpyxampvfi52muihoid.onion is up. Checked 9 hours ago.
666
5jeu-fuad.onion is down. Checked 2 hours ago.
Little Angel
5jir-m3yd.onion is up. Checked 1 hour ago.
✅CHILD TOP VIDEO✅
5jix-flqd.onion is up. Checked 6 hours ago.
SAVE YOUR COINS
5lhnl7lhi6gd3he5swkevoqu2d6aniqqpq3ertw77xary7ydbyizbfyd.onion is up. Checked 17 hours ago.
Latest Sites Checked
hyzmpq2fg4x7jrhyeap4kruohxs6owkbxeebnropoarlq6kfmcjnuaqd.onion - Dopassic Park – Where dope is as big as dinosaurs
Server is up. Last checked 32 seconds ago.
anowddbdpl7d4mo2ovi72e6llulp47qr6h6hgrvd44dv7fc56hu6ytyd.onion - ANOW — Anonymous Crypto Escrow Platform
Server is up. Last checked 36 seconds ago.
Server is up. Last checked 55 seconds ago.
Server is up. Last checked 59 seconds ago.
goodxijl5myiqnxmrq76lzhc4buu3aee4frbnt76nsa24ytgkuw25qyd.onion - Agora road Marketplace – best onion market - agora road mark ...
Server is up. Last checked 1 minute ago.
Server is up. Last checked 1 minute ago.
Server is up. Last checked 1 minute ago.
bvten5sviu2xvdgxo2zjxebqajq7qv7mdvsddzh4czso6rdpwtclokad.onion - Beneath VT – Exploring Virginia Tech's steam tunnels and bey ...
Server is up. Last checked 2 minutes ago.
btc75f5yfeul6nwwzua2vyyfrqksnfqiby4vjfo57d4lqqit4rernxid.onion - Bitcoin Wallet | Buy Bitcoin Wallets 2026
Server is up. Last checked 2 minutes ago.
Server is up. Last checked 2 minutes ago.
Down Right Now
nnr2divekgyallk2v2gvv677snlpc2kh6eoasxr7q3zq56kcukdmhjyd.onion - Cloned cards buy � CLONED CARDS WITH PIN
Server is down. Last checked 21 seconds ago.
nullmesrll647fi66mt6emm4ujbdctlkywfwkqghrdhacewawceittad.onion - NULL Message - Self-destructed encrypted messages
Server is down. Last checked 25 seconds ago.
nlg6nueddb7bz66s5uwiny4zwsjxj3xnsje2zmvtyhjyyson42a6rgid.onion - Credit Card Dumps - PayPal transfer BTC
Server is down. Last checked 28 seconds ago.
bh2r53z4y6oy46pwbz4ujfi6qmnaz6pv6ng6cqjp7gday277jzcu5uid.onion - Site hosted by Daniel's sdfs fsd hosting service
Server is down. Last checked 29 seconds ago.
hosting2t672fmnylbc5t7wz6zksjdwolv7xspinatyylriiv6giadad.onion - Hostings accepting cryptocurrency payments
Server is down. Last checked 30 seconds ago.
bh3ixcdsub6eezlpnpchzofrqao37ljvc2dv366qlvgmyhafeiyyvcad.onion - Site hosted by giel's hosting service
Server is down. Last checked 33 seconds ago.
Server is down. Last checked 34 seconds ago.
Server is down. Last checked 35 seconds ago.
Server is down. Last checked 42 seconds ago.
Server is down. Last checked 42 seconds ago.