Check It Onion ?
"Check It Onion" monitors the status of your favorite web sites and checks whether they are down or not. Check a website status easily by using the below test tool. Just enter the url and a fresh site status test will be performed on the domain name in real time using our online website checker tool.
To ensure your privacy and security, the Tor Browser is recommended for visiting this website. You can download the Tor Browser by visiting torproject.org. After installing the Tor Browser, copy the onion address below to continue visiting the "Check It Onion" website.
Check It Onion address: http://checkitzh2q35xf42lrtxc6a4o2aqpvvu5dpdophhl44rnqla7ffpkid.onion
Enter a keyword or domain below to check whether it is down or not...
Search Result - The Truth Lion
The Fruits Slotmachine
ognakcpa7xljr3xhkruljkroeehw2jfehwca3bm64asoluuikbxaxoad.onion is down. Checked 4 hours ago.
The page is temporarily unavailable
omgo-v3ad.onion is down. Checked 22 hours ago.
Omen's Little Home on the Dark Net
omensx7ucu4gossi2nwn3l227ka73vsob36yytr3oe32u63ftgi4t4qd.onion is down. Checked 14 hours ago.
The Leak Stuff of Dark Web
omg2-xbyd.onion is down. Checked 1 day ago.
GameStore - The best components for gaming computers and gaming laptops at low prices.
r2amwflu6fgbcxybrljpuhnm6vi542hh4oawcnda4i3guagg3adu2oqd.onion is down. Checked 21 hours ago.
strike
r32duinsdrzukn3c3bkukevjuwxdsaquyr5welc3dqutgm3wnfoa35yd.onion is down. Checked 1 day ago.
SECRETCASH - VERIFIED DARKNET MARKET - BEST PRICE GUARANTEE
r4zbmobyalfzfejwxu2633qfr6nx62khkdznqwlpc5ozkhadxpe5edqd.onion is down. Checked 2 hours ago.
SeXy
qzwnq3k7ahr4qkvj3tpguyg3hglr6fj4krtpxv3k2bj2cbm5y75yxjqd.onion is down. Checked 19 hours ago.
Good Links - Tor
rafnfimy6w334y36ksaabs5l3gshp6vbeil4maehdydau4cmqp52lnyd.onion is down. Checked 1 day ago.
SHOP BanKor CREDIT CARDS
rh2cgvtafecqn7bh2iqtv6kay3nmc4x6rr2qfxogiofc5xebvqwby5qd.onion is down. Checked 17 hours ago.
#the-asylum IRC
rk35egmweeepm4ypflmfvysf73o24ivmzzh6kk6cgxpmstns3d7qznid.onion is down. Checked 1 day ago.
RA GOLD MARKET - Anonymous Market
rm3v-zxad.onion is down. Checked 1 day ago.
Devil Engine for Hidden Services
rinnegan7hmaturk54vy53xx7kmy6alo2vcvhs7ao3hxirubq7myibid.onion is down. Checked 18 hours ago.
MisteryBox ./THE AUTHENTIC DARKNET BOX
rj3tsvyjrd7ggqmh6vga7qjawtrhgc3dyswwpkmq62z5hmzeewd3e2qd.onion is down. Checked 9 hours ago.
/the-darkside-pharma/home
rmv7cxje25sdeck6jvkv2aiumnqtkvgdpfltpwdtbkzsddgjoodeecqd.onion is down. Checked 1 day ago.
(Untitled)
ramvbfg7kzgeoyacausokob67xw4gigpdywnfufznfllc4na57c7nuid.onion is down. Checked 9 hours ago.
Normal Security - A Practical Privacy & Security Guide
rejc-j2id.onion is down. Checked 1 day ago.
reiya
reiy-kqad.onion is down. Checked 1 day ago.
RemedyRow | Remedy Row
remedyuojekvjf2qyxtlasrqu73kmltbkuhnxlhaqvyyfb6ngm7i6oyd.onion is down. Checked 1 day ago.
Inbox List - ICRO.IR Emails - Hacked by Black Reward
rbxm3tltqxnznt6xm6kyk5bgpcbet6cwujgwjaaudnld5rrtdfdp6mqd.onion is down. Checked 1 day ago.
Latest Sites Checked
hyzmpq2fg4x7jrhyeap4kruohxs6owkbxeebnropoarlq6kfmcjnuaqd.onion - Dopassic Park – Where dope is as big as dinosaurs
Server is up.
Last checked 30 seconds ago.
anowddbdpl7d4mo2ovi72e6llulp47qr6h6hgrvd44dv7fc56hu6ytyd.onion - ANOW — Anonymous Crypto Escrow Platform
Server is up.
Last checked 34 seconds ago.
Server is up.
Last checked 53 seconds ago.
Server is up.
Last checked 57 seconds ago.
goodxijl5myiqnxmrq76lzhc4buu3aee4frbnt76nsa24ytgkuw25qyd.onion - Agora road Marketplace – best onion market - agora road mark ...
Server is up.
Last checked 1 minute ago.
Server is up.
Last checked 1 minute ago.
Server is up.
Last checked 1 minute ago.
bvten5sviu2xvdgxo2zjxebqajq7qv7mdvsddzh4czso6rdpwtclokad.onion - Beneath VT – Exploring Virginia Tech's steam tunnels and bey ...
Server is up.
Last checked 2 minutes ago.
btc75f5yfeul6nwwzua2vyyfrqksnfqiby4vjfo57d4lqqit4rernxid.onion - Bitcoin Wallet | Buy Bitcoin Wallets 2026
Server is up.
Last checked 2 minutes ago.
ahzwqc5tkj6yoyndadl4aajoi76zgxwklrr6zwlf2xi3od6rdodn42qd.onion - Stolen Cryptocurrency Wallets
Server is up.
Last checked 2 minutes ago.
Down Right Now
nnr2divekgyallk2v2gvv677snlpc2kh6eoasxr7q3zq56kcukdmhjyd.onion - Cloned cards buy � CLONED CARDS WITH PIN
Server is down.
Last checked 19 seconds ago.
nullmesrll647fi66mt6emm4ujbdctlkywfwkqghrdhacewawceittad.onion - NULL Message - Self-destructed encrypted messages
Server is down.
Last checked 23 seconds ago.
nlg6nueddb7bz66s5uwiny4zwsjxj3xnsje2zmvtyhjyyson42a6rgid.onion - Credit Card Dumps - PayPal transfer BTC
Server is down.
Last checked 26 seconds ago.
bh2r53z4y6oy46pwbz4ujfi6qmnaz6pv6ng6cqjp7gday277jzcu5uid.onion - Site hosted by Daniel's sdfs fsd hosting service
Server is down.
Last checked 27 seconds ago.
hosting2t672fmnylbc5t7wz6zksjdwolv7xspinatyylriiv6giadad.onion - Hostings accepting cryptocurrency payments
Server is down.
Last checked 28 seconds ago.
bh3ixcdsub6eezlpnpchzofrqao37ljvc2dv366qlvgmyhafeiyyvcad.onion - Site hosted by giel's hosting service
Server is down.
Last checked 31 seconds ago.
Server is down.
Last checked 32 seconds ago.
Server is down.
Last checked 33 seconds ago.
Server is down.
Last checked 40 seconds ago.
Server is down.
Last checked 40 seconds ago.