Check It Onion ?

"Check It Onion" monitors the status of your favorite web sites and checks whether they are down or not. Check a website status easily by using the below test tool. Just enter the url and a fresh site status test will be performed on the domain name in real time using our online website checker tool.

To ensure your privacy and security, the Tor Browser is recommended for visiting this website. You can download the Tor Browser by visiting torproject.org. After installing the Tor Browser, copy the onion address below to continue visiting the "Check It Onion" website.

Check It Onion address: http://checkitzh2q35xf42lrtxc6a4o2aqpvvu5dpdophhl44rnqla7ffpkid.onion

Enter a keyword or domain below to check whether it is down or not...

Search Result - Encrypted messages on Tor · Crow
Log in | XDED.BZ - dedicated servers online shop
z27jflykecyifoefvikrqxrkqizzmvcflc7md4gg2gvdjppni4yrz5qd.onion is up. Checked 3 hours ago.
DonaldTrump Market - Log In
zdmx-3qyd.onion is down. Checked 1 day ago.
(Untitled)
yyvga7kt64nr6jmzqsumzpwno26eqjulhppzv5yvhmgdcaj2dkdz2nid.onion is down. Checked 19 hours ago.
lulzsec muslims forum
z7mpzmyk7peuk4oesqufgx5u6zg3klxgxrqscehse7tjlefsibwpmcqd.onion is down. Checked 21 hours ago.
(Untitled)
z7m7ogzdhu43nosvjtsuplfmuqa3ge5obahixydhmzdox6owwxfoxzid.onion is up. Checked 23 hours ago.
BuscaBrasil
z4mwowkl7tguqnlgnpyawjn5ryolewxchlgaovmgrctxs6qflyhjfvyd.onion is down. Checked 23 hours ago.
Xmatches - fixed football matches
ypjm-ikyd.onion is up. Checked 10 hours ago.
(Untitled)
ygzg6qzkaiygjs6t2wlulc4rhqzlvhhyot7jlf3bo665cnpo2lt4obid.onion is up. Checked 8 hours ago.
[OFFICIAL & ORIGINAL] BITCOIN x200 SERVICE - ®2019
ym2h-fqad.onion is down. Checked 19 hours ago.
secure login payment
ympn-hcad.onion is up. Checked 15 minutes ago.
Wikipedia, the free encyclopedia
ybgg-z5qd.onion is up. Checked 15 hours ago.
tpablo.net
y6gupgneeoxkfwatrv5tpablodgfpx7t5go3k5netbrt5ji726tn4wad.onion is up. Checked 5 hours ago.
Surveillance Self-Defense
y7ye-jeyd.onion is up. Checked 6 hours ago.
Onion Link List - Dark Web Directory
ybir-thqd.onion is down. Checked 12 hours ago.
Exchange | Intercambio
ybnc-lbyd.onion is up. Checked 19 hours ago.
Bitcoin Generator Exploit - Make Free Bitcoins!
yfvy-2bad.onion is down. Checked 5 hours ago.
CashMan - PAYMENT
yo7z-nlqd.onion is up. Checked 7 hours ago.
Onion Links | Only trusted websites
yo4x-sgyd.onion is up. Checked 3 hours ago.
Hire Hacker
yokp-nkid.onion is up. Checked 3 hours ago.
Latest Sites Checked
hyzmpq2fg4x7jrhyeap4kruohxs6owkbxeebnropoarlq6kfmcjnuaqd.onion - Dopassic Park – Where dope is as big as dinosaurs
Server is up. Last checked 32 seconds ago.
anowddbdpl7d4mo2ovi72e6llulp47qr6h6hgrvd44dv7fc56hu6ytyd.onion - ANOW — Anonymous Crypto Escrow Platform
Server is up. Last checked 36 seconds ago.
Server is up. Last checked 55 seconds ago.
Server is up. Last checked 59 seconds ago.
goodxijl5myiqnxmrq76lzhc4buu3aee4frbnt76nsa24ytgkuw25qyd.onion - Agora road Marketplace – best onion market - agora road mark ...
Server is up. Last checked 1 minute ago.
Server is up. Last checked 1 minute ago.
Server is up. Last checked 1 minute ago.
bvten5sviu2xvdgxo2zjxebqajq7qv7mdvsddzh4czso6rdpwtclokad.onion - Beneath VT – Exploring Virginia Tech's steam tunnels and bey ...
Server is up. Last checked 2 minutes ago.
btc75f5yfeul6nwwzua2vyyfrqksnfqiby4vjfo57d4lqqit4rernxid.onion - Bitcoin Wallet | Buy Bitcoin Wallets 2026
Server is up. Last checked 2 minutes ago.
Server is up. Last checked 2 minutes ago.
Down Right Now
nnr2divekgyallk2v2gvv677snlpc2kh6eoasxr7q3zq56kcukdmhjyd.onion - Cloned cards buy � CLONED CARDS WITH PIN
Server is down. Last checked 21 seconds ago.
nullmesrll647fi66mt6emm4ujbdctlkywfwkqghrdhacewawceittad.onion - NULL Message - Self-destructed encrypted messages
Server is down. Last checked 25 seconds ago.
nlg6nueddb7bz66s5uwiny4zwsjxj3xnsje2zmvtyhjyyson42a6rgid.onion - Credit Card Dumps - PayPal transfer BTC
Server is down. Last checked 28 seconds ago.
bh2r53z4y6oy46pwbz4ujfi6qmnaz6pv6ng6cqjp7gday277jzcu5uid.onion - Site hosted by Daniel's sdfs fsd hosting service
Server is down. Last checked 29 seconds ago.
hosting2t672fmnylbc5t7wz6zksjdwolv7xspinatyylriiv6giadad.onion - Hostings accepting cryptocurrency payments
Server is down. Last checked 30 seconds ago.
bh3ixcdsub6eezlpnpchzofrqao37ljvc2dv366qlvgmyhafeiyyvcad.onion - Site hosted by giel's hosting service
Server is down. Last checked 33 seconds ago.
Server is down. Last checked 34 seconds ago.
Server is down. Last checked 35 seconds ago.
Server is down. Last checked 42 seconds ago.
Server is down. Last checked 42 seconds ago.