Check It Onion ?
"Check It Onion" monitors the status of your favorite web sites and checks whether they are down or not. Check a website status easily by using the below test tool. Just enter the url and a fresh site status test will be performed on the domain name in real time using our online website checker tool.
To ensure your privacy and security, the Tor Browser is recommended for visiting this website. You can download the Tor Browser by visiting torproject.org. After installing the Tor Browser, copy the onion address below to continue visiting the "Check It Onion" website.
Check It Onion address: http://checkitzh2q35xf42lrtxc6a4o2aqpvvu5dpdophhl44rnqla7ffpkid.onion
Enter a keyword or domain below to check whether it is down or not...
Search Result - Encrypted messages on Tor · Crow
Dark Web Hackers
zkj7-7zid.onion is up. Checked 10 hours ago.
keys.openpgp.org
zkaa-mbad.onion is up. Checked 6 hours ago.
(Untitled)
zky65z2xlvu4l24rjn3mzkyzrc6cmiqrzouzcvtfgcvvvevok5vbgjyd.onion is up. Checked 14 hours ago.
(Untitled)
zb2jtkhnbvhkya3d46twv3g7lkobi4s62tjffqmafjibixk6pmq75did.onion is up. Checked 18 hours ago.
(Untitled)
yxuy5oard6zn25hgjmtp3fmndimfwljhw44u4jappxthbfbli6ycyrqd.onion is up. Checked 5 hours ago.
Top Skimmers
yxty-vnid.onion is up. Checked 2 hours ago.
sethfoster.tech
zifewwhacylo5bnwyrwgmipuuchkt6efhahmvxis2by3qlcaqiye5lyd.onion is up. Checked 1 hour ago.
ASSASSINATION FOR HIRE - KILLER CONTACT
z4eh-5nad.onion is up. Checked 15 hours ago.
(Untitled)
z3wo-keid.onion is up. Checked 1 day ago.
Xhacker
z4od-tnid.onion is up. Checked 6 hours ago.
The Light Hidden Wiki - The oldest wiki catalogue in TOR. Light version
zaej-qryd.onion is up. Checked 2 hours ago.
/test/ - P34975 this
z5lcip4dafatwwa6hvyibizpzwycvwp67cjga3hzjhxhwvuyaqavxnid.onion is up. Checked 54 minutes ago.
DARKNETPEDIA
zatovgoqrjxk4wrq5gsmnogh6htkownegvws4mpnwbdfqpnxsn4vbgqd.onion is down. Checked 6 hours ago.
Ящик
zedb-bjid.onion is up. Checked 14 hours ago.
taz.de | taz.de
zerv-gqyd.onion is up. Checked 3 hours ago.
ZeroTrace — Secure Verification
zerotrinycpgmocwtopa7tvfd7o2eimu4z3oqxnblfhmoz7a67pvxlid.onion is up. Checked 6 hours ago.
List of available projects - HTTrack Website Copier
z3ytypu4kuh6hpmx5jl5vnjihwybwv54zejj5fxndd6xxqdm6mlq4jid.onion is down. Checked 1 day ago.
DragonForce | Queue
z3wqggtxft7id3ibr7srivv5gjof5fwg76slewnzwwakjuf3nlhukdid.onion is up. Checked 10 hours ago.
Quick Money
zakq-5mid.onion is up. Checked 7 hours ago.
Latest Sites Checked
hyzmpq2fg4x7jrhyeap4kruohxs6owkbxeebnropoarlq6kfmcjnuaqd.onion - Dopassic Park – Where dope is as big as dinosaurs
Server is up.
Last checked 30 seconds ago.
anowddbdpl7d4mo2ovi72e6llulp47qr6h6hgrvd44dv7fc56hu6ytyd.onion - ANOW — Anonymous Crypto Escrow Platform
Server is up.
Last checked 34 seconds ago.
Server is up.
Last checked 53 seconds ago.
Server is up.
Last checked 57 seconds ago.
goodxijl5myiqnxmrq76lzhc4buu3aee4frbnt76nsa24ytgkuw25qyd.onion - Agora road Marketplace – best onion market - agora road mark ...
Server is up.
Last checked 1 minute ago.
Server is up.
Last checked 1 minute ago.
Server is up.
Last checked 1 minute ago.
bvten5sviu2xvdgxo2zjxebqajq7qv7mdvsddzh4czso6rdpwtclokad.onion - Beneath VT – Exploring Virginia Tech's steam tunnels and bey ...
Server is up.
Last checked 2 minutes ago.
btc75f5yfeul6nwwzua2vyyfrqksnfqiby4vjfo57d4lqqit4rernxid.onion - Bitcoin Wallet | Buy Bitcoin Wallets 2026
Server is up.
Last checked 2 minutes ago.
ahzwqc5tkj6yoyndadl4aajoi76zgxwklrr6zwlf2xi3od6rdodn42qd.onion - Stolen Cryptocurrency Wallets
Server is up.
Last checked 2 minutes ago.
Down Right Now
nnr2divekgyallk2v2gvv677snlpc2kh6eoasxr7q3zq56kcukdmhjyd.onion - Cloned cards buy � CLONED CARDS WITH PIN
Server is down.
Last checked 19 seconds ago.
nullmesrll647fi66mt6emm4ujbdctlkywfwkqghrdhacewawceittad.onion - NULL Message - Self-destructed encrypted messages
Server is down.
Last checked 23 seconds ago.
nlg6nueddb7bz66s5uwiny4zwsjxj3xnsje2zmvtyhjyyson42a6rgid.onion - Credit Card Dumps - PayPal transfer BTC
Server is down.
Last checked 26 seconds ago.
bh2r53z4y6oy46pwbz4ujfi6qmnaz6pv6ng6cqjp7gday277jzcu5uid.onion - Site hosted by Daniel's sdfs fsd hosting service
Server is down.
Last checked 27 seconds ago.
hosting2t672fmnylbc5t7wz6zksjdwolv7xspinatyylriiv6giadad.onion - Hostings accepting cryptocurrency payments
Server is down.
Last checked 28 seconds ago.
bh3ixcdsub6eezlpnpchzofrqao37ljvc2dv366qlvgmyhafeiyyvcad.onion - Site hosted by giel's hosting service
Server is down.
Last checked 31 seconds ago.
Server is down.
Last checked 32 seconds ago.
Server is down.
Last checked 33 seconds ago.
Server is down.
Last checked 40 seconds ago.
Server is down.
Last checked 40 seconds ago.