Check It Onion ?

"Check It Onion" monitors the status of your favorite web sites and checks whether they are down or not. Check a website status easily by using the below test tool. Just enter the url and a fresh site status test will be performed on the domain name in real time using our online website checker tool.

To ensure your privacy and security, the Tor Browser is recommended for visiting this website. You can download the Tor Browser by visiting torproject.org. After installing the Tor Browser, copy the onion address below to continue visiting the "Check It Onion" website.

Check It Onion address: http://checkitzh2q35xf42lrtxc6a4o2aqpvvu5dpdophhl44rnqla7ffpkid.onion

Enter a keyword or domain below to check whether it is down or not...

Search Result - Porn Darkweb Directory - TOP 50 Topic Links
Tornado — Search Engine
tornadoxn3viscgz647shlysdy7ea5zqzwda7hierekeuokh5eh5b3qd.onion is down. Checked 1 day ago.
TORTOP — Rich Links List
tort-wgyd.onion is down. Checked 1 day ago.
Ahmia - Free - Zzoo
tftt6ymvxgv5tpgh5b3j2iabjlduyjhyuoey7m7vlv6lofrr35qm55id.onion is down. Checked 1 day ago.
Zoo - Zoo - YVids - Zzoo - Porn
vlyd4khpmaecwqitewx4sqhynt77a4bwl33xd2uk3evz4sn3snxw6aid.onion is down. Checked 1 day ago.
Onion || Links || Lesbian ❤️
vott-f3yd.onion is down. Checked 1 day ago.
Onion || Community || Topic Links || Links || Links
voyq-f7id.onion is down. Checked 1 day ago.
Uncensored Links 2025
vna7-e5yd.onion is down. Checked 1 day ago.
El ConquTestador | Mis mejores enlaces verificados y comprobados | My best verified and tested links | Home
vezb7mb7ckkdae6z2vuuyh2vr3qiuimjcj45g6pc4tpckwbyp2o4hoad.onion is down. Checked 1 day ago.
Onion || Free || Porn || Cute || Download ❤️
vdx7-3iad.onion is down. Checked 1 day ago.
Porn - Ch1ld - Zoo - Preview
vh3a-hnid.onion is down. Checked 1 day ago.
Excavator - search in darknet
vewpeefs756ggisq4wkh7pattadini3uyro4h55vlnkzmxh5yai72dqd.onion is down. Checked 15 hours ago.
OnionLand - Ch1ld - TORCH
vkivvghyaqvk35anxfjgrgcnomechxmbpcqqph2rnudhwatihrlnsfyd.onion is down. Checked 2 hours ago.
Lzziistudios - Ahmia - Zoo - OnionLand - Porn - Onion
vxxo5xxs26mqeppwtjfl3i7rzmva27iaivue277bi3zdhsz24e4mrhyd.onion is down. Checked 1 day ago.
Hidden Links – Smart Catalogue
wcle-icid.onion is down. Checked 19 hours ago.
Excavator - search in darknet
wcbpomq3lu4tc2p34mfmidozc4i5uujcr4pkqetyzz3xwfoj72qdk4id.onion is down. Checked 15 hours ago.
Buy Counterfeit Money Online - Counterfeit Money For Sale
wgy2-luqd.onion is down. Checked 19 hours ago.
Excavator - search in darknet
w3id5dyehosbutka544r25fd57xpxcpjehabbfto2gudhzxytodyijqd.onion is down. Checked 1 day ago.
Featured Onion Links | DarkDir - Onion Directory
w3xg-osyd.onion is down. Checked 1 day ago.
Latest Sites Checked
hyzmpq2fg4x7jrhyeap4kruohxs6owkbxeebnropoarlq6kfmcjnuaqd.onion - Dopassic Park – Where dope is as big as dinosaurs
Server is up. Last checked 28 seconds ago.
anowddbdpl7d4mo2ovi72e6llulp47qr6h6hgrvd44dv7fc56hu6ytyd.onion - ANOW — Anonymous Crypto Escrow Platform
Server is up. Last checked 32 seconds ago.
Server is up. Last checked 51 seconds ago.
Server is up. Last checked 55 seconds ago.
goodxijl5myiqnxmrq76lzhc4buu3aee4frbnt76nsa24ytgkuw25qyd.onion - Agora road Marketplace – best onion market - agora road mark ...
Server is up. Last checked 1 minute ago.
Server is up. Last checked 1 minute ago.
Server is up. Last checked 1 minute ago.
bvten5sviu2xvdgxo2zjxebqajq7qv7mdvsddzh4czso6rdpwtclokad.onion - Beneath VT – Exploring Virginia Tech's steam tunnels and bey ...
Server is up. Last checked 1 minute ago.
btc75f5yfeul6nwwzua2vyyfrqksnfqiby4vjfo57d4lqqit4rernxid.onion - Bitcoin Wallet | Buy Bitcoin Wallets 2026
Server is up. Last checked 2 minutes ago.
Server is up. Last checked 2 minutes ago.
Down Right Now
nnr2divekgyallk2v2gvv677snlpc2kh6eoasxr7q3zq56kcukdmhjyd.onion - Cloned cards buy � CLONED CARDS WITH PIN
Server is down. Last checked 17 seconds ago.
nullmesrll647fi66mt6emm4ujbdctlkywfwkqghrdhacewawceittad.onion - NULL Message - Self-destructed encrypted messages
Server is down. Last checked 21 seconds ago.
nlg6nueddb7bz66s5uwiny4zwsjxj3xnsje2zmvtyhjyyson42a6rgid.onion - Credit Card Dumps - PayPal transfer BTC
Server is down. Last checked 24 seconds ago.
bh2r53z4y6oy46pwbz4ujfi6qmnaz6pv6ng6cqjp7gday277jzcu5uid.onion - Site hosted by Daniel's sdfs fsd hosting service
Server is down. Last checked 25 seconds ago.
hosting2t672fmnylbc5t7wz6zksjdwolv7xspinatyylriiv6giadad.onion - Hostings accepting cryptocurrency payments
Server is down. Last checked 26 seconds ago.
bh3ixcdsub6eezlpnpchzofrqao37ljvc2dv366qlvgmyhafeiyyvcad.onion - Site hosted by giel's hosting service
Server is down. Last checked 29 seconds ago.
Server is down. Last checked 30 seconds ago.
Server is down. Last checked 31 seconds ago.
Server is down. Last checked 38 seconds ago.
Server is down. Last checked 38 seconds ago.