Check It Onion ?
"Check It Onion" monitors the status of your favorite web sites and checks whether they are down or not. Check a website status easily by using the below test tool. Just enter the url and a fresh site status test will be performed on the domain name in real time using our online website checker tool.
To ensure your privacy and security, the Tor Browser is recommended for visiting this website. You can download the Tor Browser by visiting torproject.org. After installing the Tor Browser, copy the onion address below to continue visiting the "Check It Onion" website.
Check It Onion address: http://checkitzh2q35xf42lrtxc6a4o2aqpvvu5dpdophhl44rnqla7ffpkid.onion
Enter a keyword or domain below to check whether it is down or not...
Search Result - Leave a word
Sky Host - Best Tor Network Hosting Services
yuugwz527rcwzhicwdtzd6dmxtnd5dpb5upr7xnd7ii4dzemzhkxfyad.onion is down. Checked 20 hours ago.
Home – mig5 system administration
yvhz-yvid.onion is up. Checked 4 hours ago.
Porn Hacker
yv37-qeid.onion is down. Checked 21 hours ago.
Liturgia Di�ria OnLine
yql3-smad.onion is up. Checked 18 hours ago.
(Untitled)
yryh2hdh2wvt5h5dimqxg5zavxffw7siyoyyzs3ppjcgx6npkkmis6ad.onion is down. Checked 1 day ago.
Prepaid Card | Cloned Credit Cards and Money Transfers via PayPal or Western Union
yryk-cjad.onion is up. Checked 7 hours ago.
Facebook – log in or sign up
yeur-5syd.onion is down. Checked 1 day ago.
Welcome | Dagbladet | SecureDrop
ydbpz5knb6ji3bdtahhm3wo7sed6lsy5vqnwfpnhpez4bquvoexbz7qd.onion is up. Checked 18 hours ago.
Home | Activism Archive
yd43paeb65fcuykc4skel6ra2r4qluqicuxjr4wqxgrsn6ti3mlrczad.onion is up. Checked 5 hours ago.
Hidden Wiki FRESH Catalog of onion sites | Tor dir list
ynlditcsbxbi3braw3ikpbhrfqm3tqlcambkyiev5jjq6ddalldu27id.onion is up. Checked 9 hours ago.
Apple Store - iPhone 16 Out Now !
y6yl-67qd.onion is down. Checked 1 day ago.
(Untitled)
y7ubfhr7ptimshz2m5uirtsky3tgpkw4e4iclxdqziqicr5barulotqd.onion is down. Checked 1 day ago.
| PHARMA FRANCE |
yaex-z5yd.onion is up. Checked 4 hours ago.
Fresh Fullz Info & Cvv Shop - Yale Lodge shop 🔐
yale-wxid.onion is down. Checked 10 hours ago.
Apache2 Ubuntu Default Page: It works
yeab-4gad.onion is up. Checked 23 hours ago.
Green PASS
yeb7-fwid.onion is up. Checked 5 hours ago.
(Untitled)
yeyvffnl7m6c6cg3v5ei3iturpycea3ggz3sjtwis4v5jw574akmnzyd.onion is up. Checked 14 hours ago.
Rainbow Youth - Index page
yj3p-ybad.onion is up. Checked 10 hours ago.
4get
4getwebfpjss7ygrbt6s4nqdh4ycxgxxcutmixfkc2asbtlr6k6i3oqd.onion is up. Checked 4 hours ago.
matangarudvguvnm56tpczx2qw6pnmnhxq72z4nm55pbh47pdw57zkyd.onion
matangarudvguvnm56tpczx2qw6pnmnhxq72z4nm55pbh47pdw57zkyd.onion is up. Checked 23 hours ago.
Latest Sites Checked
hyzmpq2fg4x7jrhyeap4kruohxs6owkbxeebnropoarlq6kfmcjnuaqd.onion - Dopassic Park – Where dope is as big as dinosaurs
Server is up.
Last checked 32 seconds ago.
anowddbdpl7d4mo2ovi72e6llulp47qr6h6hgrvd44dv7fc56hu6ytyd.onion - ANOW — Anonymous Crypto Escrow Platform
Server is up.
Last checked 36 seconds ago.
Server is up.
Last checked 55 seconds ago.
Server is up.
Last checked 59 seconds ago.
goodxijl5myiqnxmrq76lzhc4buu3aee4frbnt76nsa24ytgkuw25qyd.onion - Agora road Marketplace – best onion market - agora road mark ...
Server is up.
Last checked 1 minute ago.
Server is up.
Last checked 1 minute ago.
Server is up.
Last checked 1 minute ago.
bvten5sviu2xvdgxo2zjxebqajq7qv7mdvsddzh4czso6rdpwtclokad.onion - Beneath VT – Exploring Virginia Tech's steam tunnels and bey ...
Server is up.
Last checked 2 minutes ago.
btc75f5yfeul6nwwzua2vyyfrqksnfqiby4vjfo57d4lqqit4rernxid.onion - Bitcoin Wallet | Buy Bitcoin Wallets 2026
Server is up.
Last checked 2 minutes ago.
ahzwqc5tkj6yoyndadl4aajoi76zgxwklrr6zwlf2xi3od6rdodn42qd.onion - Stolen Cryptocurrency Wallets
Server is up.
Last checked 2 minutes ago.
Down Right Now
nnr2divekgyallk2v2gvv677snlpc2kh6eoasxr7q3zq56kcukdmhjyd.onion - Cloned cards buy � CLONED CARDS WITH PIN
Server is down.
Last checked 21 seconds ago.
nullmesrll647fi66mt6emm4ujbdctlkywfwkqghrdhacewawceittad.onion - NULL Message - Self-destructed encrypted messages
Server is down.
Last checked 25 seconds ago.
nlg6nueddb7bz66s5uwiny4zwsjxj3xnsje2zmvtyhjyyson42a6rgid.onion - Credit Card Dumps - PayPal transfer BTC
Server is down.
Last checked 28 seconds ago.
bh2r53z4y6oy46pwbz4ujfi6qmnaz6pv6ng6cqjp7gday277jzcu5uid.onion - Site hosted by Daniel's sdfs fsd hosting service
Server is down.
Last checked 29 seconds ago.
hosting2t672fmnylbc5t7wz6zksjdwolv7xspinatyylriiv6giadad.onion - Hostings accepting cryptocurrency payments
Server is down.
Last checked 30 seconds ago.
bh3ixcdsub6eezlpnpchzofrqao37ljvc2dv366qlvgmyhafeiyyvcad.onion - Site hosted by giel's hosting service
Server is down.
Last checked 33 seconds ago.
Server is down.
Last checked 34 seconds ago.
Server is down.
Last checked 35 seconds ago.
Server is down.
Last checked 42 seconds ago.
Server is down.
Last checked 42 seconds ago.